PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010090051.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family LBD
Protein Properties Length: 277aa    MW: 30826.7 Da    PI: 7.8769
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010090051.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260112.82.3e-35101082100
          DUF260   2 CaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelal 96 
                     Ca Ck++r++C ++C +apyfp+++ k+f+n+h+lFGasnv+k+++++++ +++d+++sl+ e++ar +dPv+G++g+i+ l++qle +++ela+
  XP_010090051.1  10 CACCKLQRKNCDQQCEFAPYFPSTRFKEFQNAHRLFGASNVQKIMASVKPGQKKDTADSLLAEGNARRSDPVHGCYGIIRGLESQLEFAEKELAA 104
                     **********************************************************************************************9 PP

          DUF260  97 lkee 100
                     ++++
  XP_010090051.1 105 VNRH 108
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.9338109IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-3310106IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 277 aa     Download sequence    Send to blast
MALSSEHQTC ACCKLQRKNC DQQCEFAPYF PSTRFKEFQN AHRLFGASNV QKIMASVKPG  60
QKKDTADSLL AEGNARRSDP VHGCYGIIRG LESQLEFAEK ELAAVNRHLA LYRERVIWKH  120
KRRTQAAGME QLMILRGRGG GGNGLNNPVR ASPVLTISPP PMAYAPVRDD HQQQDHHDRQ  180
MLDGVQFPRA IDLNTEAHDG YVYQSTLEEG SALSPFDLQR IDQMVASLQQ GNILGSLDEI  240
RDQFSASFKE NGKRNIVGKE KVEEAGSSAK GNEFVGN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010090051.10.0hypothetical protein L484_027282
TrEMBLW9QS620.0W9QS62_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF144321117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13850.11e-33LOB domain-containing protein 22